Reaction Details |
| Report a problem with these data |
Target | Thioredoxin |
---|
Ligand | BDBM50426063 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_934906 (CHEMBL2319792) |
---|
IC50 | 450±n/a nM |
---|
Citation | DiRaimondo, TR; Plugis, NM; Jin, X; Khosla, C Selective inhibition of extracellular thioredoxin by asymmetric disulfides. J Med Chem56:1301-10 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thioredoxin |
---|
Name: | Thioredoxin |
Synonyms: | ADF | ATL-derived factor | SASP | Surface-associated sulphydryl protein | THIO_HUMAN | TRDX | TRX | TRX1 | TXN |
Type: | PROTEIN |
Mol. Mass.: | 11732.84 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_934906 |
Residue: | 105 |
Sequence: | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
|
|
|
BDBM50426063 |
---|
n/a |
---|
Name | BDBM50426063 |
Synonyms: | CHEMBL2315290 |
Type | Small organic molecule |
Emp. Form. | C15H18N2S2 |
Mol. Mass. | 290.447 |
SMILES | C1CCC(CC1)SSc1nc(c[nH]1)-c1ccccc1 |
Structure |
|