Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50431036 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_947846 (CHEMBL2343122) |
---|
Ki | 19.0±n/a nM |
---|
Citation | Díaz, JL; Christmann, U; Fernández, A; Luengo, M; Bordas, M; Enrech, R; Carro, M; Pascual, R; Burgueño, J; Merlos, M; Benet-Buchholz, J; Cerón-Bertran, J; Ramírez, J; Reinoso, RF; Fernández de Henestrosa, AR; Vela, JM; Almansa, C Synthesis and biological evaluation of a new series of hexahydro-2H-pyrano[3,2-c]quinolines as novel selectives1 receptor ligands. J Med Chem56:3656-65 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50431036 |
---|
n/a |
---|
Name | BDBM50431036 |
Synonyms: | CHEMBL2338760 |
Type | Small organic molecule |
Emp. Form. | C23H35NO |
Mol. Mass. | 341.5301 |
SMILES | CCCCCc1ccc2N[C@H](C3CCCCC3)[C@@H]3CCCO[C@@H]3c2c1 |r| |
Structure |
|