Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50292907 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_973122 (CHEMBL2412885) |
---|
Ki | 191±n/a nM |
---|
Citation | Li, J; Zhang, X; Zhang, Z; Padakanti, PK; Jin, H; Cui, J; Li, A; Zeng, D; Rath, NP; Flores, H; Perlmutter, JS; Parsons, SM; Tu, Z Heteroaromatic and aniline derivatives of piperidines as potent ligands for vesicular acetylcholine transporter. J Med Chem56:6216-33 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50292907 |
---|
n/a |
---|
Name | BDBM50292907 |
Synonyms: | (+)-trans-(4-fluorophenyl)(1-(3-hydroxy-1,2,3,4-tetrahydronaphthalen-2-yl)piperidin-4-yl)methanone | (+/-)-trans-2-Hydroxy-3-(4-(4-fluorobenzoyl)piperidino)tetralin | (-)-trans(4-fluorophenyl)(1-(3-hydroxy-1,2,3,4-tetrahydronaphthalen-2-yl)piperidin-4-yl)methanone | CHEMBL473129 |
Type | Small organic molecule |
Emp. Form. | C22H24FNO2 |
Mol. Mass. | 353.4299 |
SMILES | O[C@@H]1Cc2ccccc2C[C@H]1N1CCC(CC1)C(=O)c1ccc(F)cc1 |r| |
Structure |
|