Reaction Details |
| Report a problem with these data |
Target | Heme oxygenase 1 |
---|
Ligand | BDBM85747 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_988012 (CHEMBL2438670) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Vlahakis, JZ; Vukomanovic, D; Nakatsu, K; Szarek, WA Selective inhibition of heme oxygenase-2 activity by analogs of 1-(4-chlorobenzyl)-2-(pyrrolidin-1-ylmethyl)-1H-benzimidazole (clemizole): Exploration of the effects of substituents at the N-1 position. Bioorg Med Chem21:6788-95 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Heme oxygenase 1 |
---|
Name: | Heme oxygenase 1 |
Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
Type: | Enzyme |
Mol. Mass.: | 33005.15 |
Organism: | Rattus norvegicus (rat) |
Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
Residue: | 289 |
Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
BDBM85747 |
---|
n/a |
---|
Name | BDBM85747 |
Synonyms: | CAS_442-52-4 | CLEMIZOLE HYDROCHLORIDE | NSC_2782 | clemizole |
Type | Small organic molecule |
Emp. Form. | C19H20ClN3 |
Mol. Mass. | 325.835 |
SMILES | Clc1ccc(Cn2c(CN3CCCC3)nc3ccccc23)cc1 |
Structure |
|