Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50448056 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1289501 (CHEMBL3117417) |
---|
IC50 | 90±n/a nM |
---|
Citation | El-Subbagh, HI; Hassan, GS; El-Messery, SM; Al-Rashood, ST; Al-Omary, FA; Abulfadl, YS; Shabayek, MI Nonclassical antifolates, part 5. Benzodiazepine analogs as a new class of DHFR inhibitors: synthesis, antitumor testing and molecular modeling study. Eur J Med Chem74:234-45 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
Type: | Enzyme |
Mol. Mass.: | 21603.71 |
Organism: | Bos taurus (Cattle) |
Description: | P00376 |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
BDBM50448056 |
---|
n/a |
---|
Name | BDBM50448056 |
Synonyms: | CHEMBL3115736 |
Type | Small organic molecule |
Emp. Form. | C32H34N2O6 |
Mol. Mass. | 542.6222 |
SMILES | COc1cc(C=C2CCCC3C2=Nc2ccccc2N=C3c2cc(OC)c(OC)c(OC)c2)cc(OC)c1OC |w:5.4,c:21,t:12| |
Structure |
|