| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50009304 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1335472 (CHEMBL3239224) |
|---|
| Ki | 0.900000±n/a nM |
|---|
| Citation |  Weber, F; Brune, S; Korpis, K; Bednarski, PJ; Laurini, E; Dal Col, V; Pricl, S; Schepmann, D; Wünsch, B Synthesis, pharmacological evaluation, ands1 receptor interaction analysis of hydroxyethyl substituted piperazines. J Med Chem57:2884-94 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50009304 |
|---|
| n/a |
|---|
| Name | BDBM50009304 |
|---|
| Synonyms: | CHEMBL3233531 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H34N2O |
|---|
| Mol. Mass. | 366.5396 |
|---|
| SMILES | OCC[C@@H]1CN(CC2CCCCC2)CCN1Cc1cccc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
