Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50009311 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1335476 (CHEMBL3239228) |
---|
Ki | 465±n/a nM |
---|
Citation | Weber, F; Brune, S; Korpis, K; Bednarski, PJ; Laurini, E; Dal Col, V; Pricl, S; Schepmann, D; Wünsch, B Synthesis, pharmacological evaluation, ands1 receptor interaction analysis of hydroxyethyl substituted piperazines. J Med Chem57:2884-94 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50009311 |
---|
n/a |
---|
Name | BDBM50009311 |
Synonyms: | CHEMBL3233536 |
Type | Small organic molecule |
Emp. Form. | C23H32N2O |
Mol. Mass. | 352.513 |
SMILES | CCCCN1CCN(Cc2ccc(cc2)-c2ccccc2)[C@@H](CCO)C1 |r| |
Structure |
|