Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Retinol-binding protein 4 |
---|
Ligand | BDBM50026259 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1441244 (CHEMBL3380009) |
---|
IC50 | 24±n/a nM |
---|
Citation | Cioffi, CL; Dobri, N; Freeman, EE; Conlon, MP; Chen, P; Stafford, DG; Schwarz, DM; Golden, KC; Zhu, L; Kitchen, DB; Barnes, KD; Racz, B; Qin, Q; Michelotti, E; Cywin, CL; Martin, WH; Pearson, PG; Johnson, G; Petrukhin, K Design, synthesis, and evaluation of nonretinoid retinol binding protein 4 antagonists for the potential treatment of atrophic age-related macular degeneration and Stargardt disease. J Med Chem57:7731-57 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinol-binding protein 4 |
---|
Name: | Retinol-binding protein 4 |
Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
Type: | Protein |
Mol. Mass.: | 23008.75 |
Organism: | Homo sapiens (Human) |
Description: | P02753 |
Residue: | 201 |
Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
BDBM50026259 |
---|
n/a |
---|
Name | BDBM50026259 |
Synonyms: | CHEMBL3359023 |
Type | Small organic molecule |
Emp. Form. | C22H22F3N3O3 |
Mol. Mass. | 433.4236 |
SMILES | [H][C@@]12C[C@@H](C[C@]1([H])CN(C2)C(=O)Nc1cc(C)ncc1C(O)=O)c1ccccc1C(F)(F)F |r| |
Structure |
|