Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Galectin-1 |
---|
Ligand | BDBM50048091 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1454622 (CHEMBL3361811) |
---|
Kd | 3600000±n/a nM |
---|
Citation | Rajput, VK; Leffler, H; Nilsson, UJ; Mukhopadhyay, B Synthesis and evaluation of iminocoumaryl and coumaryl derivatized glycosides as galectin antagonists. Bioorg Med Chem Lett24:3516-20 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Galectin-1 |
---|
Name: | Galectin-1 |
Synonyms: | 14 kDa lectin | Galaptin | HPL | LEG1_HUMAN | LGALS1 | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12 |
Type: | beta galactoside-binding protein |
Mol. Mass.: | 14713.53 |
Organism: | Homo sapiens (Human) |
Description: | P09382 |
Residue: | 135 |
Sequence: | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
|
|
|
BDBM50048091 |
---|
n/a |
---|
Name | BDBM50048091 |
Synonyms: | CHEMBL3311520 |
Type | Small organic molecule |
Emp. Form. | C23H25NO9S |
Mol. Mass. | 491.511 |
SMILES | Cc1ccc(cc1)S(=O)(=O)\N=c1/oc2ccccc2cc1CO[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O |r| |
Structure |
|