Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50077867 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1473395 (CHEMBL3419512) |
---|
Ki | 194±n/a nM |
---|
Citation | Díaz, JL; Christmann, U; Fernández, A; Torrens, A; Port, A; Pascual, R; Álvarez, I; Burgueño, J; Monroy, X; Montero, A; Balada, A; Vela, JM; Almansa, C Synthesis and structure-activity relationship study of a new series of selectives(1) receptor ligands for the treatment of pain: 4-aminotriazoles. J Med Chem58:2441-51 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50077867 |
---|
n/a |
---|
Name | BDBM50077867 |
Synonyms: | CHEMBL3417076 | US9611229, 23 |
Type | Small organic molecule |
Emp. Form. | C15H19Cl2N5O |
Mol. Mass. | 356.25 |
SMILES | Clc1ccc(cc1Cl)-n1cc(NCCCN2CCOCC2)nn1 |
Structure |
|