| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 1 |
|---|
| Ligand | BDBM50080274 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1506093 (CHEMBL3595959) |
|---|
| Ki | 3000000±n/a nM |
|---|
| Citation |  Fonseca, EM; Trivella, DB; Scorsato, V; Dias, MP; Bazzo, NL; Mandapati, KR; de Oliveira, FL; Ferreira-Halder, CV; Pilli, RA; Miranda, PC; Aparicio, R Crystal structures of the apo form and a complex of human LMW-PTP with a phosphonic acid provide new evidence of a secondary site potentially related to the anchorage of natural substrates. Bioorg Med Chem23:4462-71 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 1 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 1 |
|---|
| Synonyms: | PTN1_HUMAN | PTP1B | PTPN1 | Protein tyrosine phosphatase 1B (PTP1B) | Protein tyrosine phosphatase-1B (PTP1B) | Protein-tyrosine phosphatase 1B | Protein-tyrosine phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase non-receptor type 1 | Tyrosine-protein phosphatase non-receptor type 1 (PTP1B) |
|---|
| Type: | Protein phosphatase |
|---|
| Mol. Mass.: | 49963.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human recombinant GST-fusion PTP1B (1-435). |
|---|
| Residue: | 435 |
|---|
| Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
|
|
|
|---|
| BDBM50080274 |
|---|
| n/a |
|---|
| Name | BDBM50080274 |
|---|
| Synonyms: | Benzyl-phosphonic acid | CHEMBL299737 | Phenyl-methanephosphonic acid anion | benzylphosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H9O3P |
|---|
| Mol. Mass. | 172.1183 |
|---|
| SMILES | OP(O)(=O)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
