| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50018094 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1507629 (CHEMBL3600040) |
|---|
| Ki | 74±n/a nM |
|---|
| Citation |  Tu, Z; Zhang, X; Jin, H; Yue, X; Padakanti, PK; Yu, L; Liu, H; Flores, HP; Kaneshige, K; Parsons, SM; Perlmutter, JS Synthesis and biological characterization of a promising F-18 PET tracer for vesicular acetylcholine transporter. Bioorg Med Chem23:4699-709 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50018094 |
|---|
| n/a |
|---|
| Name | BDBM50018094 |
|---|
| Synonyms: | (1R,2R)-2-(4-Phenyl-piperidin-1-yl)-cyclohexanol | 2-(4-Phenyl-piperidin-1-yl)-cyclohexanol | 2-(4-Phenyl-piperidin-1-yl)-cyclohexanol(Vesamicol) | CHEMBL20730 | Vesamicol | trans-2-(4-phenylpiperidin-1-yl)cyclohexanol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H25NO |
|---|
| Mol. Mass. | 259.3865 |
|---|
| SMILES | O[C@@H]1CCCC[C@H]1N1CCC(CC1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
