Reaction Details |
| Report a problem with these data |
Target | CCR4-NOT transcription complex subunit 7 |
---|
Ligand | BDBM50119760 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1518114 (CHEMBL3619397) |
---|
IC50 | 38600±n/a nM |
---|
Citation | Jadhav, GP; Kaur, I; Maryati, M; Airhihen, B; Fischer, PM; Winkler, GS Discovery, synthesis and biochemical profiling of purine-2,6-dione derivatives as inhibitors of the human poly(A)-selective ribonuclease Caf1. Bioorg Med Chem Lett25:4219-24 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
CCR4-NOT transcription complex subunit 7 |
---|
Name: | CCR4-NOT transcription complex subunit 7 |
Synonyms: | BTG1-binding factor 1 | CAF-1 | CAF1 | CCR4-NOT transcription complex subunit 7 | CCR4-associated factor 1 | CNOT7 | CNOT7_HUMAN | Caf1a |
Type: | PROTEIN |
Mol. Mass.: | 32730.66 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_109881 |
Residue: | 285 |
Sequence: | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFK
MREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
|
|
|
BDBM50119760 |
---|
n/a |
---|
Name | BDBM50119760 |
Synonyms: | CHEMBL1735036 |
Type | Small organic molecule |
Emp. Form. | C11H8N4O3 |
Mol. Mass. | 244.2062 |
SMILES | On1c(=O)[nH]c2cnn(-c3ccccc3)c2c1=O |
Structure |
|