Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50142688 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1552594 (CHEMBL3762399) |
---|
IC50 | 1930±n/a nM |
---|
Citation | Peduto, A; Krauth, V; Collarile, S; Dehm, F; Ambruosi, M; Belardo, C; Guida, F; Massa, A; Esposito, V; Maione, S; de Rosa, M; Werz, O; Filosa, R Exploring the role of chloro and methyl substitutions in 2-phenylthiomethyl-benzoindole derivatives for 5-LOX enzyme inhibition. Eur J Med Chem108:466-75 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50142688 |
---|
n/a |
---|
Name | BDBM50142688 |
Synonyms: | CHEMBL3759494 |
Type | Small organic molecule |
Emp. Form. | C25H25NO3S |
Mol. Mass. | 419.536 |
SMILES | CCOC(=O)c1c(CSc2c(C)cc(C)cc2C)[nH]c2c1cc(O)c1ccccc21 |
Structure |
|