Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM102980 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1574205 (CHEMBL3802020) |
---|
Ki | 12±n/a nM |
---|
Citation | Maingot, M; Blayo, AL; Denoyelle, S; M'Kadmi, C; Damian, M; Mary, S; Gagne, D; Sanchez, P; Aicher, B; Schmidt, P; Müller, G; Teifel, M; Günther, E; Marie, J; Banères, JL; Martinez, J; Fehrentz, JA New ligands of the ghrelin receptor based on the 1,2,4-triazole scaffold by introduction of a second chiral center. Bioorg Med Chem Lett26:2408-12 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM102980 |
---|
n/a |
---|
Name | BDBM102980 |
Synonyms: | US8546435, 8 |
Type | Small organic molecule |
Emp. Form. | C36H40N8O3 |
Mol. Mass. | 632.7546 |
SMILES | COc1ccc(Cn2c(nnc2[C@@H](Cc2c[nH]c3ccccc23)NC(=O)C(C)(C)N)[C@@H](Cc2c[nH]c3ccccc23)NC(C)=O)cc1 |r| |
Structure |
|