| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM26989 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1633802 (CHEMBL3876594) |
|---|
| Ki | 6800000±n/a nM |
|---|
| Citation |  Del Prete, S; Vullo, D; Di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of theż-carbonic anhydrase from the pathogenic bacterium Burkholderia pseudomallei responsible of melioidosis and highly drug resistant to common antibiotics. Bioorg Med Chem25:575-580 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | CAH_METTT | CAM | Carbonic anhydrase | Gamma-carbonic anhydrase |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26390.56 |
|---|
| Organism: | Methanosarcina thermophila |
|---|
| Description: | P40881 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MMFNKQIFTILILSLSLALAGSGCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAP
VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETI
NEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGN
NCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLA
EGYKETS
|
|
|
|---|
| BDBM26989 |
|---|
| n/a |
|---|
| Name | BDBM26989 |
|---|
| Synonyms: | CHEMBL93268 | NO2- | nitrite | nitrite ion |
|---|
| Type | Ion |
|---|
| Emp. Form. | NO2 |
|---|
| Mol. Mass. | 46.006 |
|---|
| SMILES | [O-]N=O |
|---|
| Structure | 
|
|---|
Search and Browse
