Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase type 1 |
---|
Ligand | BDBM50291795 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54572 (CHEMBL664886) |
---|
Ki | 646±n/a nM |
---|
Citation | Coats, EA; Genther, CS; Selassie, CD; Strong, CD; Hansch, C Quantitative structure-activity relationship of antifolate inhibition of bacteria cell cultures resistant and sensitive to methotrexate. J Med Chem28:1910-6 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase type 1 |
---|
Name: | Dihydrofolate reductase type 1 |
Synonyms: | DYR1_ECOLX | dhfrI |
Type: | PROTEIN |
Mol. Mass.: | 17574.87 |
Organism: | Escherichia coli |
Description: | ChEMBL_54248 |
Residue: | 157 |
Sequence: | MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
|
|
|
BDBM50291795 |
---|
n/a |
---|
Name | BDBM50291795 |
Synonyms: | CHEMBL441503 | {3-[3-(4,6-Diamino-2,2-dimethyl-2H-[1,3,5]triazin-1-yl)-benzyloxy]-phenyl}-methanol |
Type | Small organic molecule |
Emp. Form. | C19H23N5O2 |
Mol. Mass. | 353.4182 |
SMILES | CC1(C)N=C(N)N=C(N)N1c1cccc(COc2cccc(CO)c2)c1 |t:3,6| |
Structure |
|