Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Orexin/Hypocretin receptor type 1 |
---|
Ligand | BDBM205113 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1650584 |
---|
Ki | 1611±n/a nM |
---|
Citation | Skudlarek, JW; DiMarco, CN; Babaoglu, K; Roecker, AJ; Bruno, JG; Pausch, MA; O'Brien, JA; Cabalu, TD; Stevens, J; Brunner, J; Tannenbaum, PL; Wuelfing, WP; Garson, SL; Fox, SV; Savitz, AT; Harrell, CM; Gotter, AL; Winrow, CJ; Renger, JJ; Kuduk, SD; Coleman, PJ Investigation of orexin-2 selective receptor antagonists: Structural modifications resulting in dual orexin receptor antagonists. Bioorg Med Chem Lett27:1364-1370 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Orexin/Hypocretin receptor type 1 |
---|
Name: | Orexin/Hypocretin receptor type 1 |
Synonyms: | HCRTR1 | Hypocretin receptor type 1 | OX1R_HUMAN | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r |
Type: | Protein |
Mol. Mass.: | 47554.50 |
Organism: | Homo sapiens (Human) |
Description: | O43613 |
Residue: | 425 |
Sequence: | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
|
|
|
BDBM205113 |
---|
n/a |
---|
Name | BDBM205113 |
Synonyms: | 3-methyl-2-({(3r,6r)-6- methyl-1-[(3-phenylpyridin-4- yl)carbonyl]piperidin-3- yl}oxy)pyridine-4-carbonitrile | US9546152, example 23 |
Type | Small organic molecule |
Emp. Form. | C25H24N4O2 |
Mol. Mass. | 412.4837 |
SMILES | C[C@@H]1CC[C@H](CN1C(=O)c1ccncc1-c1ccccc1)Oc1nccc(C#N)c1C |r| |
Structure |
|