| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM82472 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 501.19±n/a nM |
|---|
| Comments | PDSP_456 |
|---|
| Citation |  Baxter, GS Novel discriminatory ligands for 5-HT2B receptors. Behav Brain Res73:149-52 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM82472 |
|---|
| n/a |
|---|
| Name | BDBM82472 |
|---|
| Synonyms: | BW-723C86 | CAS_5311036 | NSC_5311036 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H18N2OS |
|---|
| Mol. Mass. | 286.392 |
|---|
| SMILES | CC(N)Cc1c[nH]c2ccc(OCc3cccs3)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
