Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Melatonin receptor |
---|
Ligand | BDBM85066 |
---|
Substrate/Competitor | n/a |
---|
Ki | 3.5±n/a nM |
---|
Comments | PDSP_1124 |
---|
Citation | Dubocovich, ML; Masana, MI; Iacob, S; Sauri, DM Melatonin receptor antagonists that differentiate between the human Mel1a and Mel1b recombinant subtypes are used to assess the pharmacological profile of the rabbit retina ML1 presynaptic heteroreceptor. Naunyn Schmiedebergs Arch Pharmacol355:365-75 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Melatonin receptor |
---|
Name: | Melatonin receptor |
Synonyms: | Melatonin | Melatonin receptor |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 13287.02 |
Organism: | RABBIT |
Description: | Q9BE38 |
Residue: | 114 |
Sequence: | MIWMLTLVAVMPNLHTGTLQYDPRVYSCTFSQSVSSAYTIAVVVFHFIIPMLMSSCCYLR
IWILVLQVRRRVKPDNKPKLKPQDFRNFITMFVVFVLFAICWAPLNFIVLLGRS
|
|
|
BDBM85066 |
---|
n/a |
---|
Name | BDBM85066 |
Synonyms: | Luzindole,5-Methoxy |
Type | Small organic molecule |
Emp. Form. | C20H22N2O2 |
Mol. Mass. | 322.4009 |
SMILES | COc1ccc2[nH]c(Cc3ccccc3)c(CCNC(C)=O)c2c1 |
Structure |
|