Reaction Details |
| Report a problem with these data |
Target | Promotilin |
---|
Ligand | BDBM86001 |
---|
Substrate/Competitor | n/a |
---|
Ki | 6918.31±n/a nM |
---|
Comments | PDSP_6185 |
---|
Citation | Thielemans, L; Depoortere, I; Vanden Broeck, J; Peeters, TL The motilin pharmacophore in CHO cells expressing the human motilin receptor. Biochem Biophys Res Commun293:1223-7 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Promotilin |
---|
Name: | Promotilin |
Synonyms: | MLN | MOTI_HUMAN | Motilin | Promotilin |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 12919.83 |
Organism: | Homo sapiens (Human) |
Description: | Motilin 0 HUMAN::P12872 |
Residue: | 115 |
Sequence: | MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEE
GPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
|
|
|
BDBM86001 |
---|
n/a |
---|
Name | BDBM86001 |
Synonyms: | [leu13]pMOT(1-7) |
Type | Small organic molecule |
Emp. Form. | C47H64N8O9 |
Mol. Mass. | 885.0593 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccccc1)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O |r| |
Structure |
|