Reaction Details |
| Report a problem with these data |
Target | Gastrin-releasing peptide |
---|
Ligand | BDBM86501 |
---|
Substrate/Competitor | n/a |
---|
Ki | 2510±n/a nM |
---|
Comments | PDSP_3743 |
---|
Citation | Mantey, SA; Coy, DH; Entsuah, LK; Jensen, RT Development of bombesin analogs with conformationally restricted amino acid substitutions with enhanced selectivity for the orphan receptor human bombesin receptor subtype 3. J Pharmacol Exp Ther310:1161-70 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Gastrin-releasing peptide |
---|
Name: | Gastrin-releasing peptide |
Synonyms: | GRP | GRP_HUMAN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 16223.81 |
Organism: | Homo sapiens (Human) |
Description: | Gastrin-Releasing peptide 0 HUMAN::P07492 |
Residue: | 148 |
Sequence: | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSS
VSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK
DVGSKGKVGRLSAPGSQREGRNPQLNQQ
|
|
|
BDBM86501 |
---|
n/a |
---|
Name | BDBM86501 |
Synonyms: | CAS_0 | NSC_0 | [D-Tyr6,(R)-Apa11-3Cl,Phe13,Nle14]Bn(6-14) |
Type | Small organic molecule |
Emp. Form. | C63H79ClN14O11 |
Mol. Mass. | 1243.842 |
SMILES | CCCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](N)Cc1ccc(O)cc1)C(C)C)c1cccc(Cl)c1)C(N)=O |r| |
Structure |
|