| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Promotilin |
|---|
| Ligand | BDBM86685 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 58.88±n/a nM |
|---|
| Comments | PDSP_6109 |
|---|
| Citation |  Thielemans, L; Depoortere, I; Perret, J; Robberecht, P; Liu, Y; Thijs, T; Carreras, C; Burgeon, E; Peeters, TL Desensitization of the human motilin receptor by motilides. J Pharmacol Exp Ther313:1397-405 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Promotilin |
|---|
| Name: | Promotilin |
|---|
| Synonyms: | MLN | MOTI_HUMAN | Motilin | Promotilin |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12919.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Motilin 0 HUMAN::P12872 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEE
GPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
|
|
|
|---|
| BDBM86685 |
|---|
| n/a |
|---|
| Name | BDBM86685 |
|---|
| Synonyms: | ABT-229 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H67NO10 |
|---|
| Mol. Mass. | 697.9393 |
|---|
| SMILES | CC[C@H]1OC(=O)[C@H](C)[C@@H](O[C@H]2C[C@](C)(C[C@H](C)O2)OC)[C@H](C)[C@@H](O[C@@H]2O[C@H](C)C[C@@H]([C@H]2O)N(C)CC)[C@@]2(C)CC(C)=C(O2)[C@H](C)[C@@H](O)[C@H]1C |c:42| |
|---|
| Structure | 
|
|---|
Search and Browse
