Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM88743 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response selectivity of inhibitors of STriatal-Enriched Phosphatase (STEP) in the dual-specificity protein-tyrosine phosphatase VHR Inhibition Assay |
---|
IC50 | 1080±n/a nM |
---|
Citation | PubChem, PC Dose Response selectivity of inhibitors of STriatal-Enriched Phosphatase (STEP) in the dual-specificity protein-tyrosine phosphatase VHR Inhibition Assay PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM88743 |
---|
n/a |
---|
Name | BDBM88743 |
Synonyms: | 1-(3-isopropoxypropyl)-3-(4-sulfamoylphenyl)thiourea | 1-(3-propan-2-yloxypropyl)-3-(4-sulfamoylphenyl)thiourea | 4-({[(3-isopropoxypropyl)amino]carbothioyl}amino)benzenesulfonamide | MLS000704352 | SMR000231045 | cid_2716725 |
Type | Small organic molecule |
Emp. Form. | C13H21N3O3S2 |
Mol. Mass. | 331.454 |
SMILES | CC(C)OCCCNC(=S)Nc1ccc(cc1)S(N)(=O)=O |
Structure |
|