Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM88810 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response selectivity of inhibitors of STriatal-Enriched Phosphatase (STEP) in the dual-specificity protein-tyrosine phosphatase VHR Inhibition Assay |
---|
IC50 | 1270±n/a nM |
---|
Citation | PubChem, PC Dose Response selectivity of inhibitors of STriatal-Enriched Phosphatase (STEP) in the dual-specificity protein-tyrosine phosphatase VHR Inhibition Assay PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM88810 |
---|
n/a |
---|
Name | BDBM88810 |
Synonyms: | (3E)-5-hydroxy-6-methyl-3-(2,3,5-trihydroxy-4-methyl-6-oxo-1-cyclohexa-2,4-dienylidene)cyclohex-5-ene-1,2,4-trione | (3E)-5-hydroxy-6-methyl-3-(2,3,5-trihydroxy-4-methyl-6-oxocyclohexa-2,4-dien-1-ylidene)cyclohex-5-ene-1,2,4-trione | (3E)-5-hydroxy-6-methyl-3-(2,3,5-trihydroxy-6-keto-4-methyl-cyclohexa-2,4-dien-1-ylidene)cyclohex-5-ene-1,2,4-trione | (3E)-6-methyl-3-[4-methyl-2,3,5-tris(oxidanyl)-6-oxidanylidene-cyclohexa-2,4-dien-1-ylidene]-5-oxidanyl-cyclohex-5-ene-1,2,4-trione | MLS002694850 | Oosporein | SMR000470848 | cid_5367836 |
Type | Small organic molecule |
Emp. Form. | C14H10O8 |
Mol. Mass. | 306.2244 |
SMILES | CC1C(=O)C(=O)C(C(=O)C1=O)=c1c(O)c(O)c(=C)c(O)c1O |(6.57,5.39,;6.57,3.85,;7.91,3.08,;9.24,3.85,;7.91,1.54,;9.24,.77,;6.57,.77,;5.24,1.54,;3.91,.77,;5.24,3.08,;3.91,3.85,;6.57,-.77,;5.24,-1.54,;3.91,-.77,;5.24,-3.08,;3.91,-3.85,;6.57,-3.85,;6.57,-5.39,;7.91,-3.08,;9.24,-3.85,;7.91,-1.54,;9.24,-.77,)| |
Structure |
|