| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitochondrial import inner membrane translocase subunit TIM10 |
|---|
| Ligand | BDBM78075 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SAR analysis of small molecule inhibitors of tim23-1: a luminescent tim10-1 yeast counterscreen. |
|---|
| IC50 | 2570±n/a nM |
|---|
| Citation |  PubChem, PC SAR analysis of small molecule inhibitors of tim23-1: a luminescent tim10-1 yeast counterscreen. PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitochondrial import inner membrane translocase subunit TIM10 |
|---|
| Name: | Mitochondrial import inner membrane translocase subunit TIM10 |
|---|
| Synonyms: | MRS11 | TIM10 | TIM10_YEAST | TPA: Essential protein of the mitochondrial intermembrane space | TPA: Essential protein of the mitochondrial intermembrane space, forms a complex with Tim9p (TIM10 complex) that delivers hydrophobic proteins to the TIM22 complex for insertion into the inner ... |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 10303.50 |
|---|
| Organism: | Saccharomyces cerevisiae S288c |
|---|
| Description: | gi_285809906 |
|---|
| Residue: | 93 |
|---|
| Sequence: | MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS
CLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF
|
|
|
|---|
| BDBM78075 |
|---|
| n/a |
|---|
| Name | BDBM78075 |
|---|
| Synonyms: | 2-(4-methylphenoxy)acetic acid [(Z)-[1-amino-2-(4-chlorophenyl)ethylidene]amino] ester | MLS000556012 | SMR000147529 | [(Z)-[1-amino-2-(4-chlorophenyl)ethylidene]amino] 2-(4-methylphenoxy)acetate | [(Z)-[1-azanyl-2-(4-chlorophenyl)ethylidene]amino] 2-(4-methylphenoxy)ethanoate | cid_5919570 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17ClN2O3 |
|---|
| Mol. Mass. | 332.781 |
|---|
| SMILES | Cc1ccc(OCC(=O)ONC(=N)Cc2ccc(Cl)cc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
