Reaction Details |
| Report a problem with these data |
Target | Mitochondrial peptide methionine sulfoxide reductase |
---|
Ligand | BDBM91491 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) |
---|
EC50 | >103890±n/a nM |
---|
Citation | PubChem, PC Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitochondrial peptide methionine sulfoxide reductase |
---|
Name: | Mitochondrial peptide methionine sulfoxide reductase |
Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25822.90 |
Organism: | Bos taurus |
Description: | gi_73586699 |
Residue: | 233 |
Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
BDBM91491 |
---|
n/a |
---|
Name | BDBM91491 |
Synonyms: | 3-bromanyl-N-[(E)-(5-nitrothiophen-2-yl)methylideneamino]benzamide | 3-bromo-N'-({5-nitro-2-thienyl}methylene)benzohydrazide | 3-bromo-N-[(E)-(5-nitro-2-thienyl)methyleneamino]benzamide | 3-bromo-N-[(E)-(5-nitro-2-thiophenyl)methylideneamino]benzamide | 3-bromo-N-[(E)-(5-nitrothiophen-2-yl)methylideneamino]benzamide | MLS000546648 | SMR000114095 | cid_6876664 |
Type | Small organic molecule |
Emp. Form. | C12H8BrN3O3S |
Mol. Mass. | 354.179 |
SMILES | [O-][N+](=O)c1ccc(\C=N\NC(=O)c2cccc(Br)c2)s1 |
Structure |
|