Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Mitochondrial peptide methionine sulfoxide reductase |
---|
Ligand | BDBM55750 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) |
---|
EC50 | >103971±n/a nM |
---|
Citation | PubChem, PC Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitochondrial peptide methionine sulfoxide reductase |
---|
Name: | Mitochondrial peptide methionine sulfoxide reductase |
Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25822.90 |
Organism: | Bos taurus |
Description: | gi_73586699 |
Residue: | 233 |
Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
BDBM55750 |
---|
n/a |
---|
Name | BDBM55750 |
Synonyms: | 5-(2-phenylethylamino)-3H-1,3,4-thiadiazole-2-thione | 5-(phenethylamino)-3H-1,3,4-thiadiazole-2-thione | CHEMBL290545 | MLS000765429 | SMR000289534 | cid_2916953 |
Type | Small organic molecule |
Emp. Form. | C10H11N3S2 |
Mol. Mass. | 237.344 |
SMILES | Sc1nnc(NCCc2ccccc2)s1 |
Structure |
|