Reaction Details |
| Report a problem with these data |
Target | Mitochondrial peptide methionine sulfoxide reductase |
---|
Ligand | BDBM54927 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) |
---|
EC50 | 63345±n/a nM |
---|
Citation | PubChem, PC Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitochondrial peptide methionine sulfoxide reductase |
---|
Name: | Mitochondrial peptide methionine sulfoxide reductase |
Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25822.90 |
Organism: | Bos taurus |
Description: | gi_73586699 |
Residue: | 233 |
Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
BDBM54927 |
---|
n/a |
---|
Name | BDBM54927 |
Synonyms: | 4-(benzylamino)-1,2-naphthoquinone | 4-(benzylamino)naphthalene-1,2-dione | 4-[(phenylmethyl)amino]naphthalene-1,2-dione | MLS000712297 | SMR000282064 | US9073941, 901 | cid_3095209 |
Type | Small organic molecule |
Emp. Form. | C17H13NO2 |
Mol. Mass. | 263.2906 |
SMILES | O=C1C=C(NCc2ccccc2)c2ccccc2C1=O |t:2| |
Structure |
|