Reaction Details |
| Report a problem with these data |
Target | Mitochondrial peptide methionine sulfoxide reductase |
---|
Ligand | BDBM91504 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) |
---|
EC50 | >104117±n/a nM |
---|
Citation | PubChem, PC Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitochondrial peptide methionine sulfoxide reductase |
---|
Name: | Mitochondrial peptide methionine sulfoxide reductase |
Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25822.90 |
Organism: | Bos taurus |
Description: | gi_73586699 |
Residue: | 233 |
Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
BDBM91504 |
---|
n/a |
---|
Name | BDBM91504 |
Synonyms: | 2,4 (1H,3H)-Pyrimidinedithione, 6-methyl- | 6-methyl-1H-pyrimidine-2,4-dithione | MLS000737051 | SMR000394007 | cid_816944 |
Type | Small organic molecule |
Emp. Form. | C5H6N2S2 |
Mol. Mass. | 158.245 |
SMILES | Cc1cc(=S)[nH]c(=S)[nH]1 |
Structure |
|