| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Ligand | BDBM7493 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) |
|---|
| EC50 | 15779±n/a nM |
|---|
| Citation |  PubChem, PC Absorbance-based biochemical high throughput dose response assay for activators of Methionine sulfoxide reductase A (MsrA) PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Name: | Mitochondrial peptide methionine sulfoxide reductase |
|---|
| Synonyms: | MSRA | MSRA protein | MSRA_BOVIN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25822.90 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | gi_73586699 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
|
|
|
|---|
| BDBM7493 |
|---|
| n/a |
|---|
| Name | BDBM7493 |
|---|
| Synonyms: | cid_23641117 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C20H25NO2 |
|---|
| Mol. Mass. | 311.418 |
|---|
| SMILES | [H][C@@]12C[C@@]34C(=O)C(=C)[C@@]5([H])C[C@@]3([H])[C@@]3([H])N1C[C@]1(C)CCC[C@]3([C@]21[H])[C@]4([H])[C@@]5([H])O |TLB:5:4:25.27:11.10,4:3:15:22.23,7:6:25.27:11.10,25:22:15:3.11.2,2:3:22.13:27.10.8,27:25:11:15.1.2,THB:4:3:22.13:27.10.8,23:22:11:15.1.2,23:1:22.25:11,25:3:15:22.23,17:23:15:3.11.2,2:1:22.13:17.16,16:15:22.23:3.11.2,16:15:22.25:11,10:11:15:22.23,10:11:22.25:15.1.2| |
|---|
| Structure | 
|
|---|
Search and Browse
