| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sentrin-specific protease 8 |
|---|
| Ligand | BDBM93583 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 365±39 nM |
|---|
| Citation |  PubChem, PC Dose-response confirmation of uHTS inhibitor hits of Sentrin-Specific Protease 8 using a kinetic assay with Nedd8 Protein Substrate PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sentrin-specific protease 8 |
|---|
| Name: | Sentrin-specific protease 8 |
|---|
| Synonyms: | DEN1 | NEDP1 | PRSC2 | SENP8 | SENP8_HUMAN | SUMO/sentrin specific peptidase family member 8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 24104.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_262118306 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
|
|
|
|---|
| BDBM93583 |
|---|
| n/a |
|---|
| Name | BDBM93583 |
|---|
| Synonyms: | MLS000701606 | N-[(Z)-[(3E)-3-(carbomethoxyhydrazono)indan-1-ylidene]amino]carbamic acid methyl ester | N-[(Z)-[(3E)-3-(methoxycarbonylhydrazinylidene)-1-indenylidene]amino]carbamic acid methyl ester | SMR000230285 | cid_11842271 | methyl 2-{3-[(methoxycarbonyl)hydrazono]-2,3-dihydro-1H-inden-1-ylidene}hydrazinecarboxylate | methyl N-[(Z)-[(3E)-3-(methoxycarbonylhydrazinylidene)inden-1-ylidene]amino]carbamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H14N4O4 |
|---|
| Mol. Mass. | 290.2747 |
|---|
| SMILES | COC(=O)NN=C1CC(=NNC(=O)OC)c2ccccc12 |w:5.4,9.9| |
|---|
| Structure | 
|
|---|
Search and Browse
