| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sentrin-specific protease 8 |
|---|
| Ligand | BDBM71542 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 935±63 nM |
|---|
| Citation |  PubChem, PC Dose-response confirmation of uHTS inhibitor hits of Sentrin-Specific Protease 8 using a kinetic assay with Nedd8 Protein Substrate PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sentrin-specific protease 8 |
|---|
| Name: | Sentrin-specific protease 8 |
|---|
| Synonyms: | DEN1 | NEDP1 | PRSC2 | SENP8 | SENP8_HUMAN | SUMO/sentrin specific peptidase family member 8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 24104.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_262118306 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQ
FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDS
HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR
QQTESLLQLLTPAYITKKRGEWKDLITTLAKK
|
|
|
|---|
| BDBM71542 |
|---|
| n/a |
|---|
| Name | BDBM71542 |
|---|
| Synonyms: | (4-amino-1-methyl-butyl)-(6-methoxy-8-quinolyl)amine;phosphoric acid | 4-N-(6-methoxyquinolin-8-yl)pentane-1,4-diamine;phosphoric acid | MLS001334045 | N4-(6-methoxy-8-quinolinyl)pentane-1,4-diamine;phosphoric acid | N4-(6-methoxyquinolin-8-yl)pentane-1,4-diamine;phosphoric acid | Primaquine bisphosphate | SMR000875314 | cid_359247 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H21N3O |
|---|
| Mol. Mass. | 259.3467 |
|---|
| SMILES | COc1cc(NC(C)CCCN)c2ncccc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
