Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Heat shock protein hsp-16.2 |
---|
Ligand | BDBM93719 |
---|
Substrate/Competitor | n/a |
---|
IC50 | >64000±n/a nM |
---|
Citation | PubChem, PC Dose Response Confirmation of SKN-1 Inhibitor hits via a heat-shock counterscreen assay PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article |
---|
|
Heat shock protein hsp-16.2 |
---|
Name: | Heat shock protein hsp-16.2 |
Synonyms: | HSP12_CAEEL | Protein HSP-16.2 | hsp-16 | hsp-16.2 | hsp16-2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 16239.18 |
Organism: | Caenorhabditis elegans |
Description: | gi_373219859 |
Residue: | 145 |
Sequence: | MSLYHYFRPAQRSVFGDLMRDMALMERQFAPVCRISPSESSEIVNNDQKFAINLNVSQFK
PEDLKINLDGRTLSIQGEQELKTDHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIE
APKKEAVQGRSIPIQQAIVEEKSAE
|
|
|
BDBM93719 |
---|
n/a |
---|
Name | BDBM93719 |
Synonyms: | 2-(4-methylsulfanylphenyl)chromen-4-one | 2-[4-(methylthio)phenyl]-1-benzopyran-4-one | 2-[4-(methylthio)phenyl]-4H-chromen-4-one | 2-[4-(methylthio)phenyl]chromone | MLS000089864 | SMR000024482 | cid_3245800 |
Type | Small organic molecule |
Emp. Form. | C16H12O2S |
Mol. Mass. | 268.33 |
SMILES | CSc1ccc(cc1)-c1cc(=O)c2ccccc2o1 |
Structure |
|