| Reaction Details |
|---|
 | Report a problem with these data |
| Target | T cell receptor alpha variable 4 |
|---|
| Ligand | BDBM46189 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | >94106±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence-based biochemical primary high throughput dose response assay to identify inhibitors of T-cell receptor (TCR)-CD3 interaction using a TAMRA-labeled TCR probe PubChem Bioassay(2013)[AID] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| T cell receptor alpha variable 4 |
|---|
| Name: | T cell receptor alpha variable 4 |
|---|
| Synonyms: | TCRAV4S1 | TRAV4 | TVA4_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12216.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | A0A0B4J268 |
|---|
| Residue: | 109 |
|---|
| Sequence: | MRQVARVIVFLTLSTLSLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQG
PRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD
|
|
|
|---|
| BDBM46189 |
|---|
| n/a |
|---|
| Name | BDBM46189 |
|---|
| Synonyms: | 1-[2,3-bis(2-furanyl)-6-quinoxalinyl]-3-(2-methoxyethyl)urea | 1-[2,3-bis(2-furyl)quinoxalin-6-yl]-3-(2-methoxyethyl)urea | 1-[2,3-bis(furan-2-yl)quinoxalin-6-yl]-3-(2-methoxyethyl)urea | MLS-0202055.0001 | cid_3157647 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18N4O4 |
|---|
| Mol. Mass. | 378.3813 |
|---|
| SMILES | COCCNC(=O)Nc1ccc2nc(-c3ccco3)c(nc2c1)-c1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
