Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Probable nicotinate-nucleotide adenylyltransferase |
---|
Ligand | BDBM98089 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | NaMNAT HPLC Enzyme Assay |
---|
pH | 7.5±0 |
---|
Temperature | 273.15±0 K |
---|
IC50 | 7300±0.0 nM |
---|
Citation | Moro, WB; Yang, Z; Kane, TA; Zhou, Q; Harville, S; Brouillette, CG; Brouillette, WJ SAR studies for a new class of antibacterial NAD biosynthesis inhibitors. J Comb Chem11:617-25 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Probable nicotinate-nucleotide adenylyltransferase |
---|
Name: | Probable nicotinate-nucleotide adenylyltransferase |
Synonyms: | BAMEG_4595 | Deamido-NAD(+) diphosphorylase | Deamido-NAD(+) pyrophosphorylase | NADD_BACAC | Nicotinate mononucleotide adenylyltransferase | Nicotinate-nucleotide adenylyltransferase | Nicotinate-nucleotide adenylyltransferase (NadD) | Nicotinic acid mononucleotide adenylyltransferase (NaMNAT) | nadD |
Type: | Enzyme |
Mol. Mass.: | 21955.08 |
Organism: | Bacillus anthracis |
Description: | C3L5T6 |
Residue: | 189 |
Sequence: | MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQML
ELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIE
ALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVY
IERNGLYES
|
|
|
BDBM98089 |
---|
n/a |
---|
Name | BDBM98089 |
Synonyms: | 1-[4-[(3,4-dichlorophenyl)sulfonylamino]phenyl]-3-(4-nitrophenyl)urea | Compound ID 5{1} |
Type | Small organic molecule |
Emp. Form. | C19H14Cl2N4O5S |
Mol. Mass. | 481.309 |
SMILES | [O-][N+](=O)c1ccc(NC(=O)Nc2ccc(NS(=O)(=O)c3ccc(Cl)c(Cl)c3)cc2)cc1 |
Structure |
|