Reaction Details |
| Report a problem with these data |
Target | Arachidonate 5-lipoxygenase-activating protein |
---|
Ligand | BDBM104631 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
IC50 | 28±0.0 nM |
---|
Citation | Bartolozzi, A; Bosanac, T; Chen, Z; De Lombaert, S; Dines, JA; Huber, JD; Liu, WW; Loke, PL; Morwick, TM; Olague, A; Riether, D; Tye, H; Wu, L; Zindell, RM Oxadiazole inhibitors of leukotriene production US Patent US8575201 Publication Date 11/5/2013 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Arachidonate 5-lipoxygenase-activating protein |
---|
Name: | Arachidonate 5-lipoxygenase-activating protein |
Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
Type: | Enzyme |
Mol. Mass.: | 18159.90 |
Organism: | Homo sapiens (Human) |
Description: | P20292 |
Residue: | 161 |
Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
BDBM104631 |
---|
n/a |
---|
Name | BDBM104631 |
Synonyms: | US8575201, 128 |
Type | Small organic molecule |
Emp. Form. | C21H20N8O |
Mol. Mass. | 400.4365 |
SMILES | CNc1ncccc1-c1nc(no1)C1(CCC1)c1ccc(nc1)-c1cnc(N)nc1 |
Structure |
|