Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM108362 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Luminometric Kinase Assay |
---|
pH | 7±0 |
---|
IC50 | 36.95±0.0 nM |
---|
Citation | Brzózka, K; Czardybon, W; Sabiniarz, A; Millik, M; Windak, R; Zarebski, A; Beuzen, N Compound, a process for its preparation, a pharmaceutical composition, use of a compound, a method for modulating or regulating serine/threonine kinases and a serine/threonine kinases modulating agent US Patent US8604217 Publication Date 12/10/2013 |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM108362 |
---|
n/a |
---|
Name | BDBM108362 |
Synonyms: | US8604217, 28 |
Type | Small organic molecule |
Emp. Form. | C12H6Br4N4 |
Mol. Mass. | 525.819 |
SMILES | Brc1c(Br)c(Br)c2[nH]c(Nc3ccncc3)nc2c1Br |
Structure |
|