Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM286048 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | mPGES1 enzyme assay |
---|
IC50 | 12.8±n/a nM |
---|
Citation | Li, X; He, W; Liu, X; Wang, B; Hu, Q; Jin, F; Dong, Q; Sun, P Amide derivatives and pharmaceutically acceptable salts thereof, preparation method thereof and medicinal application thereof US Patent US10081629 Publication Date 9/25/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM286048 |
---|
n/a |
---|
Name | BDBM286048 |
Synonyms: | N-(2-(3-Chlorophenyl)-1-methyl-1H-indol-5-yl)-2-(difluoromethyl)-5-(((2-fluoro-2-methyl-propanoyl)amino)methyl)nicotinamide | US10081629, Example 33 |
Type | Small organic molecule |
Emp. Form. | C27H24ClF3N4O2 |
Mol. Mass. | 528.953 |
SMILES | Cn1c(cc2cc(NC(=O)c3cc(CNC(=O)C(C)(C)F)cnc3C(F)F)ccc12)-c1cccc(Cl)c1 |
Structure |
|