| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2 group V |
|---|
| Ligand | BDBM153290 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | sPLA2V Activity Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 1.917e+4± 3.42e+3 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Bukhari, SN; Zhang, X; Jantan, I; Zhu, HL; Amjad, MW; Masand, VH Synthesis, Molecular Modeling, and Biological Evaluation of Novel 1, 3-Diphenyl-2-propen-1-one Based Pyrazolines as Anti-inflammatory Agents. Chem Biol Drug Des85:729-42 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2 group V |
|---|
| Name: | Phospholipase A2 group V |
|---|
| Synonyms: | PA2G5_HUMAN | PLA2G5 | Phospholipase A2 group V | Secretory phospholipase A2, group V (sPLA2-V) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 15682.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 138 |
|---|
| Sequence: | MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT
DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKR
NLRSYNPQYQYFPNILCS
|
|
|
|---|
| BDBM153290 |
|---|
| n/a |
|---|
| Name | BDBM153290 |
|---|
| Synonyms: | 3-(2,3-Dihydro-benzo[1,4]dioxin-6-yl)-5-(2,3-dimethoxy-naphthalen-1-yl)-4,5-dihydro-pyrazole-1-carbothioic acid amide (5a) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23N3O4S |
|---|
| Mol. Mass. | 449.522 |
|---|
| SMILES | COc1cc2ccccc2c(C2CC(=NN2C(N)=S)c2ccc3OCCOc3c2)c1OC |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
