Reaction Details |
| Report a problem with these data |
Target | Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
---|
Ligand | BDBM235360 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | TNF inhibition assay |
---|
IC50 | 5.00±n/a nM |
---|
Citation | Mjalli, AM; Gaddam, B; Polisetti, DR; Kostura, MJ; Guzel, M Tricyclic compounds as modulators of TNF-α synthesis and as PDE4 inhibitors US Patent US10085990 Publication Date 10/2/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
---|
Name: | Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
Synonyms: | LITAF | LITAF_HUMAN | LPS-induced TNF-alpha factor | PIG7 | SIMPLE | Small integral membrane protein of lysosome/late endosome | TNF-alpha | p53-induced gene 7 protein |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 17106.57 |
Organism: | Homo sapiens (Human) |
Description: | TNF-alpha 0 HUMAN::Q99732 |
Residue: | 161 |
Sequence: | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS
YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG
SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
|
|
|
BDBM235360 |
---|
n/a |
---|
Name | BDBM235360 |
Synonyms: | US10085990, Example 89 | US9393245, 89 |
Type | Small organic molecule |
Emp. Form. | C23H21ClN4O3 |
Mol. Mass. | 436.891 |
SMILES | COc1cccc2c1ncc1c2n(C2CCNCC2)c(=O)n(-c2cccc(Cl)c2)c1=O |
Structure |
|