| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
|---|
| Ligand | BDBM135821 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TNF inhibition assay |
|---|
| IC50 | 29.0±n/a nM |
|---|
| Citation |  Mjalli, AM; Gaddam, B; Polisetti, DR; Kostura, MJ; Guzel, M Tricyclic compounds as modulators of TNF-α synthesis and as PDE4 inhibitors US Patent US10085990 Publication Date 10/2/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
|---|
| Name: | Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
|---|
| Synonyms: | LITAF | LITAF_HUMAN | LPS-induced TNF-alpha factor | PIG7 | SIMPLE | Small integral membrane protein of lysosome/late endosome | TNF-alpha | p53-induced gene 7 protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17106.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | TNF-alpha 0 HUMAN::Q99732 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS
YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG
SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
|
|
|
|---|
| BDBM135821 |
|---|
| n/a |
|---|
| Name | BDBM135821 |
|---|
| Synonyms: | US10085990, Example 118 | US10568888, Example 118 | US8853226, 118 | US9393245, 118 | US9833457, 118 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H21ClN4O5S |
|---|
| Mol. Mass. | 500.955 |
|---|
| SMILES | COc1cccc2c1ncc1c2n([C@H]2CCN(C2)S(C)(=O)=O)c(=O)n(-c2cccc(Cl)c2)c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
