Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 14 |
---|
Ligand | BDBM176678 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Quenching Assay |
---|
Kd | 12000±2000 nM |
---|
Citation | Shapiro, PS; MacKerell, Jr., AD; Fletcher, S Non-ATP dependent inhibitors of extracellular signal-regulated kinase (ERK) US Patent US9115122 Publication Date 8/25/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitogen-activated protein kinase 14 |
---|
Name: | Mitogen-activated protein kinase 14 |
Synonyms: | Crk1 | Csbp1 | Csbp2 | MAP Kinase p38 alpha | MAP kinase p38 | MK14_MOUSE | Mapk14 | Mitogen-activated protein kinase 14 | Mitogen-activated protein kinase p38 alpha |
Type: | Enzyme |
Mol. Mass.: | 41281.22 |
Organism: | Mus musculus (mouse) |
Description: | The full-length open reading frame of murine p38 alpha was cloned and expressed in E. coli.. Soluble murine p38R was extracted from cell pellets and purified using ion-exchange chromatography. |
Residue: | 360 |
Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
BDBM176678 |
---|
n/a |
---|
Name | BDBM176678 |
Synonyms: | US9115122, SF-2-054 |
Type | Small organic molecule |
Emp. Form. | C17H15Cl2N5O2S2 |
Mol. Mass. | 456.369 |
SMILES | CCOc1ccc(\C=C2/SC(=S)N(CCNc3nc(Cl)nc(Cl)n3)C2=O)cc1 |
Structure |
|