| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine-xanthine phosphoribosyltransferase |
|---|
| Ligand | BDBM60896 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Growth Inhibition Assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 2600±400 nM |
|---|
| Comments | extracted |
|---|
| Citation |  De Jersey, J; Guddat, LW; Hockova, D; Keough, DT 6-oxopurine phosphoribosyltransferase inhibitors US Patent US9200020 Publication Date 12/1/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine-xanthine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine-xanthine phosphoribosyltransferase |
|---|
| Synonyms: | HGXR_PLAFG | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) | Hypoxanthine-guanine-xanthine phosphoribosyltransferase (PfHGXPRT) | LACZ |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26352.14 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | P20035 |
|---|
| Residue: | 231 |
|---|
| Sequence: | MPIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYD
IKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQ
STGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPL
WNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL
|
|
|
|---|
| BDBM60896 |
|---|
| n/a |
|---|
| Name | BDBM60896 |
|---|
| Synonyms: | US9200020, Table 3 compound 10B |
|---|
| Type | n/a |
|---|
| Emp. Form. | C11H19N5O5P |
|---|
| Mol. Mass. | 332.2728 |
|---|
| SMILES | OCCN(CCn1c[nH]c2c1nc[nH]c2=O)CCP(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
