Reaction Details |
| Report a problem with these data |
Target | Alpha-synuclein |
---|
Ligand | BDBM207873 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Inhibition Assay |
---|
EC50 | 96±n/a nM |
---|
Citation | Griffioen, G; Van Dooren, T; Rojas De La Parra, V; Allasia, S; Marchand, A; Kilonda, A; Chaltin, P Compounds for the treatment of neurodegenerative diseases US Patent US9266832 Publication Date 2/23/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Alpha-synuclein |
---|
Name: | Alpha-synuclein |
Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
Type: | Protein |
Mol. Mass.: | 14451.42 |
Organism: | Homo sapiens (Human) |
Description: | P37840 |
Residue: | 140 |
Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
BDBM207873 |
---|
n/a |
---|
Name | BDBM207873 |
Synonyms: | US9266832, Cpd030 |
Type | Small organic molecule |
Emp. Form. | C25H23ClN2O2 |
Mol. Mass. | 418.915 |
SMILES | COc1ccccc1Cc1cccc(c1)C(=O)NCCc1c[nH]c2ccc(Cl)cc12 |
Structure |
|