Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM209201 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FL5.12 Cellular Assay |
---|
EC50 | 1±n/a nM |
---|
Citation | Wang, L; Doherty, G; Wang, X; Tao, Z; Bruncko, M; Kunzer, AR; Wendt, MD; Song, X; Frey, R; Hansen, TM; Sullivan, GM; Judd, A; Souers, A Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US9266877 Publication Date 2/23/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Apoptosis regulator Bcl-XL | B2CL1_MOUSE | Bcl2l | Bcl2l1 | Bclx |
Type: | Protein |
Mol. Mass.: | 26122.63 |
Organism: | Mus musculus (Mouse) |
Description: | Q64373 |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM209201 |
---|
n/a |
---|
Name | BDBM209201 |
Synonyms: | US9266877, 147 |
Type | Small organic molecule |
Emp. Form. | C39H44N6O4S |
Mol. Mass. | 692.869 |
SMILES | COCCCC1(Cn2ncc(c2C)-c2ccc(nc2C(O)=O)N2CCc3cccc(C(=O)Nc4nc5ccccc5s4)c3C2)CCCCCC1 |
Structure |
|