Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein 5 |
---|
Ligand | BDBM212459 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Time Resolved-Fluorescence Energy Transfer (TR-FRET) Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | >50000±n/a nM |
---|
Comments | extracted |
---|
Citation | Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H Urea derivatives and their use as fatty-acid binding protein (FABP) inhibitors US Patent US9278918 Publication Date 3/8/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein 5 |
---|
Name: | Fatty acid-binding protein 5 |
Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
Type: | Enzyme |
Mol. Mass.: | 15164.79 |
Organism: | Homo sapiens (Human) |
Description: | Q01469 |
Residue: | 135 |
Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
BDBM212459 |
---|
n/a |
---|
Name | BDBM212459 |
Synonyms: | US9278918, 49 |
Type | Small organic molecule |
Emp. Form. | C19H18ClFN2O3 |
Mol. Mass. | 376.809 |
SMILES | OC(=O)C1(CCCC1)NC(=O)Nc1ccc(Cl)cc1-c1ccc(F)cc1 |
Structure |
|