Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein kinase ITK/TSK [357-620,Y512E] |
---|
Ligand | BDBM213221 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | LanthaScreen Kinase Binding Assay |
---|
IC50 | 6.3±0 nM |
---|
Citation | Harling, JD; Deakin, AM; Campos, S; Grimley, R; Chaudry, L; Nye, C; Polyakova, O; Bessant, CM; Barton, N; Somers, D; Barrett, J; Graves, RH; Hanns, L; Kerr, WJ; Solari, R Discovery of novel irreversible inhibitors of interleukin (IL)-2-inducible tyrosine kinase (Itk) by targeting cysteine 442 in the ATP pocket. J Biol Chem288:28195-206 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tyrosine-protein kinase ITK/TSK [357-620,Y512E] |
---|
Name: | Tyrosine-protein kinase ITK/TSK [357-620,Y512E] |
Synonyms: | EMT | ITK | ITK_HUMAN | Interlukin-2-inducible tyrosine kinase (Itk) | LYK |
Type: | Enzyme |
Mol. Mass.: | 30027.99 |
Organism: | Homo sapiens (Human) |
Description: | Human Itk truncation (357-620 aa) with Y512E mutation |
Residue: | 264 |
Sequence: | VIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHP
KLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEA
CVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQETSSTGTKFPVKWASPEVFSFSRYS
SKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWK
ERPEDRPAFSRLLRQLAEIAESGL
|
|
|
BDBM213221 |
---|
n/a |
---|
Name | BDBM213221 |
Synonyms: | (S)-1-(3-((4-(Piperidin-1-ylmethyl)-6-(thiazolo[5,4-b]pyridin-2-ylamino)pyridin-2-yl)amino)pyrrolidin-1-yl)prop-2-en-1-one (10) |
Type | Small organic molecule |
Emp. Form. | C24H29N7OS |
Mol. Mass. | 463.598 |
SMILES | C=CC(=O)N1CC[C@@H](C1)Nc1cc(CN2CCCCC2)cc(Nc2nc3cccnc3s2)n1 |r| |
Structure |
|