Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bcl-2-related protein A1 [1-149] |
---|
Ligand | BDBM218794 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | DELFIA |
---|
IC50 | >1e+3±n/a nM |
---|
Citation | Barile, E; Marconi, GD; De, SK; Baggio, C; Gambini, L; Salem, AF; Kashyap, MK; Castro, JE; Kipps, TJ; Pellecchia, M hBfl-1/hNOXA Interaction Studies Provide New Insights on the Role of Bfl-1 in Cancer Cell Resistance and for the Design of Novel Anticancer Agents. ACS Chem Biol12:444-455 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-related protein A1 [1-149] |
---|
Name: | Bcl-2-related protein A1 [1-149] |
Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl2-related protein A1 (Bfl-1) | GRS | HBPA1 |
Type: | Protein |
Mol. Mass.: | 19694.10 |
Organism: | Homo sapiens (Human) |
Description: | Human Bfl-1 truncation (1-149 aa) with N-terminal His-tag. |
Residue: | 171 |
Sequence: | MHHHHHHSSGVDLGTENLYFQSMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQ
NVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGI
LIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE
|
|
|
BDBM218794 |
---|
n/a |
---|
Name | BDBM218794 |
Synonyms: | Ac-AATQLRRFGDKLN-NH2 | C1A_hNOXAs |
Type | Small organic molecule |
Emp. Form. | C66H111N23O19 |
Mol. Mass. | 1530.7302 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(C)=O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(N)=O |r| |
Structure |
|