Reaction Details |
| Report a problem with these data |
Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Ligand | BDBM218795 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | DELFIA |
---|
IC50 | 23±0.5 nM |
---|
Citation | Barile, E; Marconi, GD; De, SK; Baggio, C; Gambini, L; Salem, AF; Kashyap, MK; Castro, JE; Kipps, TJ; Pellecchia, M hBfl-1/hNOXA Interaction Studies Provide New Insights on the Role of Bfl-1 in Cancer Cell Resistance and for the Design of Novel Anticancer Agents. ACS Chem Biol12:444-455 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
Type: | Membrane; Single-pass membrane protein |
Mol. Mass.: | 37332.87 |
Organism: | Homo sapiens (Human) |
Description: | Q07820 |
Residue: | 350 |
Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
BDBM218795 |
---|
n/a |
---|
Name | BDBM218795 |
Synonyms: | 130E7 | Ac-λIAQELRRIGDEFNAYYARR-NH2 |
Type | Small organic molecule |
Emp. Form. | C110H171ClN36O32 |
Mol. Mass. | 2545.21 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)C(CNC(=O)CCl)NC(C)=O)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O |r| |
Structure |
|